PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G118400.1.p
Common NameLOC101773169, SETIT_029945mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 423aa    MW: 45651.6 Da    PI: 4.825
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G118400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.92.4e-33242296155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWtpeLHerFv+av+qLGGsekAtPk +l+lmk + Lt++hvkSHLQkYR+
  Seita.2G118400.1.p 242 KARMRWTPELHERFVDAVNQLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRT 296
                         68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.241239299IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-31240298IPR009057Homeodomain-like
SuperFamilySSF466892.15E-17241296IPR009057Homeodomain-like
TIGRFAMsTIGR015579.9E-25242296IPR006447Myb domain, plants
PfamPF002492.0E-10244295IPR001005SANT/Myb domain
PfamPF143791.1E-21328372IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MERLSTNQLY SSGVPVTVPT SLPSIPASLE ESFPRLPDSQ NVLIERELRS TPVPPHQNTV  60
APIRGQFHTS TGSVGPLCSP PAVRFSSVSN PEQYSNPSPY NSQAPSTASS STLNYGSQYG  120
GFEPSLTDFP RDVGPTWCPD PVDSILGYSG DVPGGNNLTG STSLGASDDL TKQTEWWTEL  180
MNDDWKDIVD NPASAETQQV GPPAQSSISV HQSAAQQTVS SQSGEPMAVV APSPTGGSNT  240
AKARMRWTPE LHERFVDAVN QLGGSEKATP KGVLKLMKAD NLTIYHVKSH LQKYRTARYR  300
PELSEGSSEK KAASKEDIPS IDLKGSFDLT EALRLQLELQ KRLHEQLEIQ RSLQLRIEEQ  360
GKCLQMMLEQ QCIPGAEKAT DALTSAEGSK ISSEVPESST AKEVPETSQN GLTKQTESGD  420
TR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0677450.0BT067745.1 Zea mays full-length cDNA clone ZM_BFc0148N18 mRNA, complete cds.
GenBankBT0694670.0BT069467.1 Zea mays full-length cDNA clone ZM_BFb0146B10 mRNA, complete cds.
GenBankKJ7268790.0KJ726879.1 Zea mays clone pUT3420 G2-like transcription factor (GLK15) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956084.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLK3ZTL50.0K3ZTL5_SETIT; Uncharacterized protein
STRINGSi029945m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-67phosphate starvation response 1